PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DL_F7015CE89.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 175aa    MW: 19285.2 Da    PI: 11.1396
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DL_F7015CE89.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.14.4e-1493135547
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                            +r+rr++kNRe+A rsRqRK+ ++ eLe++v++L++ N++L+ 
  Traes_6DL_F7015CE89.2  93 RRQRRMIKNRESAARSRQRKQSYMMELETEVAKLKERNEELQR 135
                            79************************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-1489152IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.16291136IPR004827Basic-leucine zipper domain
CDDcd147071.26E-2093139No hitNo description
Gene3DG3DSA:1.20.5.1708.6E-1693136No hitNo description
PfamPF001701.8E-1293135IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.5E-1293137No hitNo description
PROSITE patternPS00036096111IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MLFPQSNMFA PMVNPLSLAN GLMTGAYGQG GGGGGGAPAM VSPSPTGRPV MSNGYGKMEG  60
LNLSSLSPPP MPYVFSGGLR GRKPPAMEKV VERRQRRMIK NRESAARSRQ RKQSYMMELE  120
TEVAKLKERN EELQRKQFLV IGLSHPAAFN KVKVNQRENK SQNVFNYKST YSKSG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ6220920.0HQ622092.1 Lophopyrum elongatum stress-related bZIP transcription factor (ABF6) mRNA, complete cds.
GenBankHQ7382840.0HQ738284.1 Lophopyrum elongatum stress-related bZIP transcription factor (ABF6) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010236076.16e-64PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7 isoform X1
RefseqXP_010236077.16e-64PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7 isoform X2
SwissprotQ9M7Q45e-32AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLW5H0Y31e-123W5H0Y3_WHEAT; Uncharacterized protein
STRINGMLOC_53580.12e-71(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.12e-30abscisic acid responsive elements-binding factor 2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]